DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and TpnC41C

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001246139.1 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster


Alignment Length:151 Identity:96/151 - (63%)
Similarity:120/151 - (79%) Gaps:0/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VDEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGRLE 68
            :.::||.||.|:|:.|||:||.:|.|.|.|.||..||.::|...|...|.::|.|||||.||::|
  Fly     1 MSDELTKEQTALLRNAFNAFDPEKNGYINTAMVGTILSMLGHQLDDATLADIIAEVDEDGSGQIE 65

  Fly    69 FGEFVQLAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIE 133
            |.||..|||:|:||||||||..||:||||||||:|||:|.|..|:|||:||||:||..:||:|||
  Fly    66 FEEFTTLAARFLVEEDAEAMMAELKEAFRLYDKEGNGYITTGVLREILRELDDKLTNDDLDMMIE 130

  Fly   134 EIDSDGSGTVDFDEFMEMMTG 154
            |||||||||||||||||:|||
  Fly   131 EIDSDGSGTVDFDEFMEVMTG 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 93/146 (64%)
TpnC41CNP_001246139.1 PTZ00184 1..150 CDD:185504 93/148 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469341
Domainoid 1 1.000 99 1.000 Domainoid score I4446
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I2747
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D126253at33392
OrthoFinder 1 1.000 - - FOG0001548
OrthoInspector 1 1.000 - - otm14323
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7638
99.000

Return to query results.
Submit another query.