DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and tnnc1a

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_852475.3 Gene:tnnc1a / 353247 ZFINID:ZDB-GENE-030523-1 Length:161 Species:Danio rerio


Alignment Length:150 Identity:50/150 - (33%)
Similarity:91/150 - (60%) Gaps:1/150 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EDLTPEQIAVLQKAFNSF-DHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGRLEF 69
            |.||.||....:.||:.| ...:.|.|.|:.:..::|::||....:.|:|:|:|||||.||.::|
Zfish    10 EQLTDEQKNEFRAAFDIFVQDAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDF 74

  Fly    70 GEFVQLAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIEE 134
            .||:.:..:.:.::.....::||.|.||::||..:|:|....||.:|:...:.:||.:::.::.:
Zfish    75 EEFLVMMVRCMKDDSKGRPEEELAELFRMFDKNADGYIDLDELKLMLEATGEAITEDDIEELMRD 139

  Fly   135 IDSDGSGTVDFDEFMEMMTG 154
            .|.:..|.:|:|||:|.|.|
Zfish   140 GDKNNDGKIDYDEFLEFMKG 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 48/147 (33%)
tnnc1aNP_852475.3 EFh_PEF 9..157 CDD:330173 48/146 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.