powered by:
Protein Alignment TpnC73F and Swip-1
DIOPT Version :9
Sequence 1: | NP_001287091.1 |
Gene: | TpnC73F / 39916 |
FlyBaseID: | FBgn0010424 |
Length: | 155 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001286079.1 |
Gene: | Swip-1 / 35158 |
FlyBaseID: | FBgn0032731 |
Length: | 217 |
Species: | Drosophila melanogaster |
Alignment Length: | 72 |
Identity: | 22/72 - (30%) |
Similarity: | 40/72 - (55%) |
Gaps: | 0/72 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 DLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGRLEFGE 71
:.:..||...||.||::|..:.|.:..:.:..::..:|.|.....|:::|.|||||..|::.|.|
Fly 65 EFSRNQIKDYQKTFNTYDTARDGFLDLQELKFMMEKLGAPQTHLGLKQMIAEVDEDNDGKISFRE 129
Fly 72 FVQLAAK 78
|:.:..|
Fly 130 FLLIFRK 136
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
TpnC73F | NP_001287091.1 |
PTZ00184 |
6..153 |
CDD:185504 |
22/72 (31%) |
Swip-1 | NP_001286079.1 |
EFh |
73..131 |
CDD:238008 |
18/57 (32%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.