DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and TpnC25D

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001285619.1 Gene:TpnC25D / 33752 FlyBaseID:FBgn0031692 Length:149 Species:Drosophila melanogaster


Alignment Length:145 Identity:83/145 - (57%)
Similarity:109/145 - (75%) Gaps:0/145 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGRLEFGEFVQL 75
            |::.:::|||..||.||||.|.|..:..||..|||.||...|:.||::.|.:.:|::.|..|..:
  Fly     5 EKMDIMRKAFQMFDTQKTGFIETLRLKTILNSMGQMFDDSELQALIDDNDPEDTGKVNFDGFCSI 69

  Fly    76 AAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIEEIDSDGS 140
            ||.|:.||||||:||||:|||||||::|||:|.|:.|||||..|||:|:..:||.:|.|||:|||
  Fly    70 AAHFLEEEDAEAIQKELKEAFRLYDREGNGYITTSTLKEILAALDDKLSSSDLDGIIAEIDTDGS 134

  Fly   141 GTVDFDEFMEMMTGE 155
            ||||||||||||.||
  Fly   135 GTVDFDEFMEMMAGE 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 80/141 (57%)
TpnC25DNP_001285619.1 PTZ00184 4..146 CDD:185504 79/140 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5029
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 1 1.000 - - FOG0001548
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.