DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and Spata21

DIOPT Version :10

Sequence 1:NP_524122.2 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_006539018.1 Gene:Spata21 / 329972 MGIID:3607787 Length:688 Species:Mus musculus


Alignment Length:74 Identity:23/74 - (31%)
Similarity:35/74 - (47%) Gaps:2/74 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 EEDAEAMQKELREAFRLYDK--QGNGFIPTTCLKEILKELDDQLTEQELDIMIEEIDSDGSGTVD 144
            |...|.:..:..||||.|..  .|.|.:....||.||..:....|..:::..:...|.:|.|.||
Mouse   428 ERTEEHLTLKQEEAFRSYFDIFNGPGEVDARSLKNILLLIGFTFTPAQVEEALMSADVNGDGHVD 492

  Fly   145 FDEFMEMMT 153
            |.:|:.:||
Mouse   493 FKDFLAVMT 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_524122.2 PTZ00184 6..153 CDD:185504 21/72 (29%)
Spata21XP_006539018.1 PHA03247 <5..242 CDD:223021
EFh 442..501 CDD:238008 17/58 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.