powered by:
Protein Alignment TpnC73F and Spata21
DIOPT Version :9
Sequence 1: | NP_001287091.1 |
Gene: | TpnC73F / 39916 |
FlyBaseID: | FBgn0010424 |
Length: | 155 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006539018.1 |
Gene: | Spata21 / 329972 |
MGIID: | 3607787 |
Length: | 688 |
Species: | Mus musculus |
Alignment Length: | 74 |
Identity: | 23/74 - (31%) |
Similarity: | 35/74 - (47%) |
Gaps: | 2/74 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 82 EEDAEAMQKELREAFRLYDK--QGNGFIPTTCLKEILKELDDQLTEQELDIMIEEIDSDGSGTVD 144
|...|.:..:..||||.|.. .|.|.:....||.||..:....|..:::..:...|.:|.|.||
Mouse 428 ERTEEHLTLKQEEAFRSYFDIFNGPGEVDARSLKNILLLIGFTFTPAQVEEALMSADVNGDGHVD 492
Fly 145 FDEFMEMMT 153
|.:|:.:||
Mouse 493 FKDFLAVMT 501
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
TpnC73F | NP_001287091.1 |
PTZ00184 |
6..153 |
CDD:185504 |
21/72 (29%) |
Spata21 | XP_006539018.1 |
PHA03247 |
<5..242 |
CDD:223021 |
|
EFh |
442..501 |
CDD:238008 |
17/58 (29%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167838649 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.