DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and Frq1

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster


Alignment Length:121 Identity:29/121 - (23%)
Similarity:56/121 - (46%) Gaps:23/121 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GQPFDKKILEELIEEVDEDKSGRLEFGEFVQ---LAAKFIVEEDAEAMQKELREAFRLYDKQGNG 105
            |.|  .|....:....||:..|.:||.||::   :.:|..::|       :|:.||||||...:|
  Fly    59 GDP--SKFASLVFRVFDENNDGSIEFEEFIRALSVTSKGNLDE-------KLQWAFRLYDVDNDG 114

  Fly   106 FIPTTCLKEILKEL-----------DDQLTEQELDIMIEEIDSDGSGTVDFDEFME 150
            :|....:..|:..:           |:...::.:|.:.:::|.:..|.:..:||.|
  Fly   115 YITREEMYNIVDAIYQMVGQQPQSEDENTPQKRVDKIFDQMDKNHDGKLTLEEFRE 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 29/121 (24%)
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 29/121 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.