powered by:
Protein Alignment TpnC73F and Aif1
DIOPT Version :9
Sequence 1: | NP_001287091.1 |
Gene: | TpnC73F / 39916 |
FlyBaseID: | FBgn0010424 |
Length: | 155 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006256123.1 |
Gene: | Aif1 / 29427 |
RGDID: | 61924 |
Length: | 240 |
Species: | Rattus norvegicus |
Alignment Length: | 57 |
Identity: | 20/57 - (35%) |
Similarity: | 30/57 - (52%) |
Gaps: | 0/57 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 99 YDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIEEIDSDGSGTVDFDEFMEMMTGE 155
:|..|||.|....||.:|::|....|..||..:|.|:.|....|..:.:|:.||.|:
Rat 150 FDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIREVSSGSEETFSYSDFLRMMLGK 206
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
TpnC73F | NP_001287091.1 |
PTZ00184 |
6..153 |
CDD:185504 |
18/53 (34%) |
Aif1 | XP_006256123.1 |
EFh |
150..203 |
CDD:238008 |
17/52 (33%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.