DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and Efhd2

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_080270.2 Gene:Efhd2 / 27984 MGIID:106504 Length:240 Species:Mus musculus


Alignment Length:132 Identity:35/132 - (26%)
Similarity:57/132 - (43%) Gaps:31/132 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QKTGSIPTEMVADILRL------MGQPFDKKILEELIEEVDEDKSGRL--EFGEFVQLAAKFIVE 82
            |..||...|:.|.:||.      :|:|              :..|.|:  .:.||.:.:.|.|  
Mouse    46 QALGSADDELSAKLLRRADLNQGIGEP--------------QSPSRRVFNPYTEFKEFSRKQI-- 94

  Fly    83 EDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIEEIDSDGSGTVDFDE 147
                   |::.:.|:.||...:|||....||.::::|....|...|..||:|:|.|....:.|.|
Mouse    95 -------KDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIQEVDEDFDSKLSFRE 152

  Fly   148 FM 149
            |:
Mouse   153 FL 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 35/132 (27%)
Efhd2NP_080270.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51 2/4 (50%)
EFh 96..154 CDD:238008 18/57 (32%)
EF-hand_7 97..154 CDD:290234 18/56 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.