DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and Phf24

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_006537872.1 Gene:Phf24 / 230085 MGIID:2140712 Length:431 Species:Mus musculus


Alignment Length:138 Identity:31/138 - (22%)
Similarity:52/138 - (37%) Gaps:45/138 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LMGQPFDKKILEELIEEVDEDKSGRLEFGE-----FVQLAAKFIVEEDAEAMQKELREAFRLY-- 99
            ::||    |.|...:.|.::|..|..:.|:     |.         ||:|.....|....|..  
Mouse     1 MLGQ----KALRYFLLEYEDDDDGGDDDGDDDGGLFT---------EDSEYHTPWLLPGERRLET 52

  Fly   100 DKQGNG---FIPTT-----------CLKEILKELDDQLTEQELDIMIEEIDS----------DGS 140
            |.|..|   :||..           |||::.:|:.::...:....:::|..|          ||.
Mouse    53 DSQDTGWRNWIPKATGRGEQLDHLGCLKDLPREVQEEKEAEASAPVVQEESSINRAAWERLRDGR 117

  Fly   141 GTVDFDEF 148
            | |:.:||
Mouse   118 G-VEPEEF 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 31/138 (22%)
Phf24XP_006537872.1 Zf_RING 157..229 CDD:374771
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838652
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.