DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and Phf24

DIOPT Version :10

Sequence 1:NP_524122.2 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_006537872.1 Gene:Phf24 / 230085 MGIID:2140712 Length:431 Species:Mus musculus


Alignment Length:138 Identity:31/138 - (22%)
Similarity:52/138 - (37%) Gaps:45/138 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LMGQPFDKKILEELIEEVDEDKSGRLEFGE-----FVQLAAKFIVEEDAEAMQKELREAFRLY-- 99
            ::||    |.|...:.|.::|..|..:.|:     |.         ||:|.....|....|..  
Mouse     1 MLGQ----KALRYFLLEYEDDDDGGDDDGDDDGGLFT---------EDSEYHTPWLLPGERRLET 52

  Fly   100 DKQGNG---FIPTT-----------CLKEILKELDDQLTEQELDIMIEEIDS----------DGS 140
            |.|..|   :||..           |||::.:|:.::...:....:::|..|          ||.
Mouse    53 DSQDTGWRNWIPKATGRGEQLDHLGCLKDLPREVQEEKEAEASAPVVQEESSINRAAWERLRDGR 117

  Fly   141 GTVDFDEF 148
            | |:.:||
Mouse   118 G-VEPEEF 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_524122.2 PTZ00184 6..153 CDD:185504 31/138 (22%)
Phf24XP_006537872.1 zf-RING_15 158..229 CDD:407013
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.