DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and cal-8

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_495043.1 Gene:cal-8 / 184373 WormBaseID:WBGene00017394 Length:145 Species:Caenorhabditis elegans


Alignment Length:155 Identity:46/155 - (29%)
Similarity:81/155 - (52%) Gaps:10/155 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSVDEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSG 65
            |.|:.|       |.:::.|..||....|.|..:.:...|..:|:......:|.:||:.|.|.:|
 Worm     1 MDSLKE-------AEIREVFREFDKNGDGRITRQELEVALLQLGEKASNSKIETMIEQADLDGNG 58

  Fly    66 RLEFGEFVQLAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDI 130
            .::..||:.:..:.|.:...|   :|||:.|.::||.|:|.|....|..::.:|.::|||.|...
 Worm    59 CIDIDEFLNVLRRQICDPKEE---RELRDVFNVFDKNGDGVISIDDLIFVMCQLGEKLTETEAKE 120

  Fly   131 MIEEIDSDGSGTVDFDEFMEMMTGE 155
            ||::.|.|..|.:||.||:.::.|:
 Worm   121 MIKQGDLDHDGMIDFQEFVNIIKGQ 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 43/146 (29%)
cal-8NP_495043.1 PTZ00184 7..142 CDD:185504 42/137 (31%)
EFh 8..70 CDD:238008 15/61 (25%)
EFh 81..143 CDD:238008 24/61 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.