DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and cal-1

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001256428.1 Gene:cal-1 / 179715 WormBaseID:WBGene00000285 Length:180 Species:Caenorhabditis elegans


Alignment Length:151 Identity:59/151 - (39%)
Similarity:97/151 - (64%) Gaps:6/151 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQ-PFDKKILEELIEEVDEDKSGRLEF 69
            :.||||:|...::||..||....|:|.|:.:...:|.:|| |.:::|| |:|.|||.|.:|::||
 Worm    35 KQLTPEEIDEFREAFMMFDKDGNGTISTKELGIAMRSLGQNPTEQEIL-EMINEVDIDGNGQIEF 98

  Fly    70 GEFVQLAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIEE 134
            .||..:..:.:.|.|:|.    :|||||::||.|||.|.....:..:..:..|.:|:|:|.||:|
 Worm    99 PEFCVMMKRMMKETDSEM----IREAFRVFDKDGNGVITAQEFRYFMVHMGMQFSEEEVDEMIKE 159

  Fly   135 IDSDGSGTVDFDEFMEMMTGE 155
            :|.||.|.:|::||::||:.:
 Worm   160 VDVDGDGEIDYEEFVKMMSNQ 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 58/147 (39%)
cal-1NP_001256428.1 EFh_PEF 36..177 CDD:330173 57/145 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.