DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and cal-4

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001379504.1 Gene:cal-4 / 177945 WormBaseID:WBGene00000288 Length:236 Species:Caenorhabditis elegans


Alignment Length:152 Identity:49/152 - (32%)
Similarity:90/152 - (59%) Gaps:7/152 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSVDEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMG-QPFDKKILEELIEEVDEDKSG 65
            |..|| .|||::....:||..||.....::..:.:.:.:|::| .|.::::| .::.|.|.|.:|
 Worm    66 SDADE-FTPEELQEFAQAFKLFDKDGNNTMNIKELGEAMRMLGLNPTEEELL-NMVNEYDVDGNG 128

  Fly    66 RLEFGEFVQLAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDI 130
            :::||||    .|.:.|.:.|..|:.:|.||:::||.|||:|.....|..:..:.::.:|:|:|.
 Worm   129 KIDFGEF----CKMMKEMNKETDQELIRLAFKVFDKDGNGYITAQEFKHFMTTMGERFSEEEVDE 189

  Fly   131 MIEEIDSDGSGTVDFDEFMEMM 152
            :|.|:|.||...:|.|||:.|:
 Worm   190 IIREVDKDGDEQIDLDEFVNMV 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 47/148 (32%)
cal-4NP_001379504.1 PTZ00184 68..211 CDD:185504 47/148 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.