DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and cal-3

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_500421.2 Gene:cal-3 / 177143 WormBaseID:WBGene00000287 Length:234 Species:Caenorhabditis elegans


Alignment Length:150 Identity:48/150 - (32%)
Similarity:87/150 - (57%) Gaps:4/150 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VDEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGRLE 68
            |...||.|:|...::||..||....|:|..:.:...:|.:||...::.:.|:|.:||.|.:|::|
 Worm    89 VISQLTEEEIHEFKEAFLLFDKDGNGTISIKELGVAMRALGQNPTEQQMMEIIHDVDLDGNGQVE 153

  Fly    69 FGEFVQLAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIE 133
            |.||..:..:.:.|.|:|.    :||||:::|:.|||.|.....|..:..:.....|.|::.|:.
 Worm   154 FPEFCVMMKRIMKETDSEM----IREAFKIFDRDGNGVITANEFKLFMINMGMCFDEVEVEEMMN 214

  Fly   134 EIDSDGSGTVDFDEFMEMMT 153
            |:|.||:|.:|::||:::.:
 Worm   215 EVDCDGNGEIDYEEFVKIFS 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 47/146 (32%)
cal-3NP_500421.2 PTZ00184 92..232 CDD:185504 47/143 (33%)
EFh 100..162 CDD:238008 19/61 (31%)
EFh 172..234 CDD:238008 21/65 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.