DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and pbo-1

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_497601.1 Gene:pbo-1 / 175385 WormBaseID:WBGene00003941 Length:196 Species:Caenorhabditis elegans


Alignment Length:125 Identity:30/125 - (24%)
Similarity:56/125 - (44%) Gaps:12/125 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ILRLMGQPFDKKILEELIEEVDEDKSGRLEFGEFVQLAAKF-IVEEDA----EAMQKELREAFRL 98
            |..|...|...:|::....:.:..:..::.|.:||::.:.| .:.::.    .:.:.:||.||.:
 Worm    58 IAELKQNPLGDRIIDAFFADAEVLERRKVYFKDFVKVLSHFRPINKNKPHPWNSREAKLRFAFTM 122

  Fly    99 YDKQGNGFIPTTCLKEILKEL------DDQLTEQELDIMIEEIDSDGSGTVDFDEFMEMM 152
            ||...:|.|.....::||..:      .||: ....|..:.|.|.||.|.:.|.||...|
 Worm   123 YDLNKSGTITKDEFQDILAMMIGVGVPKDQV-NSIADRTMREADRDGDGFITFQEFCNAM 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 30/125 (24%)
pbo-1NP_497601.1 EFh 115..181 CDD:238008 21/66 (32%)
EF-hand_7 116..181 CDD:290234 21/65 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.