DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and tnc-2

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_496251.1 Gene:tnc-2 / 174612 WormBaseID:WBGene00006583 Length:160 Species:Caenorhabditis elegans


Alignment Length:151 Identity:83/151 - (54%)
Similarity:111/151 - (73%) Gaps:1/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGRLEFG 70
            |.|:.:||...:|.||.||.:..|.|....|..|||.|||.|:::.|::||:|.|.|.||.:||.
 Worm    10 EKLSADQIEQFRKYFNMFDKEGKGYIRATQVGQILRTMGQAFEERDLKQLIKEFDADGSGEIEFE 74

  Fly    71 EFVQLAAKFIV-EEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIEE 134
            ||..:.|.|:| .|:.|.:::|||||||||||:|||:|..:.|::||:.|||.::|:|||.||.|
 Worm    75 EFAAMVANFVVNNENDEGLEEELREAFRLYDKEGNGYINVSDLRDILRALDDNVSEEELDEMIAE 139

  Fly   135 IDSDGSGTVDFDEFMEMMTGE 155
            ||:|||||||||||||||:||
 Worm   140 IDADGSGTVDFDEFMEMMSGE 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 80/147 (54%)
tnc-2NP_496251.1 PTZ00184 10..157 CDD:185504 79/146 (54%)
EFh 19..81 CDD:238008 27/61 (44%)
EFh 96..158 CDD:238008 44/61 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I4446
eggNOG 1 0.900 - - E33208_3BPFZ
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H113978
Inparanoid 1 1.050 171 1.000 Inparanoid score I2747
Isobase 1 0.950 - 0 Normalized mean entropy S5029
OMA 1 1.010 - - QHG28890
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 1 1.000 - - FOG0001548
OrthoInspector 1 1.000 - - otm14323
orthoMCL 1 0.900 - - OOG6_120788
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7638
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.