DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and calm-1

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_492514.2 Gene:calm-1 / 172774 WormBaseID:WBGene00009260 Length:201 Species:Caenorhabditis elegans


Alignment Length:164 Identity:45/164 - (27%)
Similarity:78/164 - (47%) Gaps:29/164 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TPEQIAVLQKAFNSFDHQKTGSIPTEM--------------VADILRLMGQPFDKKILEELIEEV 59
            |.:.|..|.|.|.:.:..|   :||.|              |..:..|...||.::|.|..    
 Worm    35 TRKDIIRLYKRFYALNPHK---VPTNMQGNRPAITTLTFEEVEKMPELKENPFKRRICEVF---- 92

  Fly    60 DEDKSGRLEFGEFVQLAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELD-DQL 123
            .||..|.|.|.:|:.:   |.|..:...:|.:|:.|||:||..|:..:....|.::::.|. |:|
 Worm    93 SEDGRGNLSFDDFLDM---FSVFSEMAPLQLKLKYAFRIYDYDGDELLGHDDLSKMIRSLTRDEL 154

  Fly   124 TEQELDI----MIEEIDSDGSGTVDFDEFMEMMT 153
            ::.|::.    :|||.|.||..:::|.||..:::
 Worm   155 SDVEVEFIIERIIEEADLDGDSSINFAEFEHVVS 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 45/162 (28%)
calm-1NP_492514.2 FRQ1 32..192 CDD:227455 45/164 (27%)
EFh 121..183 CDD:298682 19/61 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.