DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and pat-10

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_491501.1 Gene:pat-10 / 172127 WormBaseID:WBGene00003934 Length:161 Species:Caenorhabditis elegans


Alignment Length:149 Identity:70/149 - (46%)
Similarity:96/149 - (64%) Gaps:0/149 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGRLEFGE 71
            ::...||...||.|::||..|.|.|....:..|:..|.|.||:|.|.:||.:.|.|.||:|||.|
 Worm    11 EIDGSQIEEYQKFFDAFDRGKQGYIMATQIGQIMHGMEQDFDEKTLRKLIRKFDADGSGKLEFDE 75

  Fly    72 FVQLAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIEEID 136
            |..|........|.|.::|||||||||:||:|||:|....||.:|||:.|.||:|:|:..::|||
 Worm    76 FCALVYTVANTVDKETLEKELREAFRLFDKEGNGYISRPTLKALLKEIADDLTDQQLEEAVDEID 140

  Fly   137 SDGSGTVDFDEFMEMMTGE 155
            .||||.::|:||.|:|.||
 Worm   141 EDGSGKIEFEEFWELMAGE 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 67/145 (46%)
pat-10NP_491501.1 EFh_PEF 16..156 CDD:330173 67/139 (48%)
EF-hand motif 21..47 CDD:320054 9/25 (36%)
EF-hand motif 55..94 CDD:320054 15/38 (39%)
EF-hand motif 95..124 CDD:320054 19/28 (68%)
EF-hand motif 131..156 CDD:320054 12/24 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5029
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 1 1.000 - - FOG0001548
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.