DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and CALML6

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_005244786.2 Gene:CALML6 / 163688 HGNCID:24193 Length:203 Species:Homo sapiens


Alignment Length:154 Identity:54/154 - (35%)
Similarity:83/154 - (53%) Gaps:2/154 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSVDEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGR 66
            :.:.|.|:.|||...:..|..||.:..|.:.|..:..::.|:|....|..|..:.::||.|..|.
Human    46 TDMTERLSAEQIKEYKGVFEMFDEEGNGEVKTGELEWLMSLLGINPTKSELASMAKDVDRDNKGF 110

  Fly    67 LEFGEFVQLAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIM 131
            .....|  ||...:..|.|:..:.|||.|||::||:|.|:|....||.:|....:.|.|.|.:.|
Human   111 FNCDGF--LALMGVYHEKAQNQESELRAAFRVFDKEGKGYIDWNTLKYVLMNAGEPLNEVEAEQM 173

  Fly   132 IEEIDSDGSGTVDFDEFMEMMTGE 155
            ::|.|.||..|:|::||:.|||||
Human   174 MKEADKDGDRTIDYEEFVAMMTGE 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 50/146 (34%)
CALML6XP_005244786.2 PTZ00184 48..195 CDD:185504 50/148 (34%)
EFh 59..120 CDD:238008 16/62 (26%)
EFh 133..195 CDD:238008 27/61 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001548
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.