DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and Caln1

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_006504429.3 Gene:Caln1 / 140904 MGIID:2155987 Length:274 Species:Mus musculus


Alignment Length:140 Identity:44/140 - (31%)
Similarity:65/140 - (46%) Gaps:38/140 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 QPFDKKIL-------------------EELIEEV--DEDKSGRLEFGEFV-----------QLAA 77
            |||.:.:|                   :||.|::  ....:|.|..|.::           |||.
Mouse    23 QPFRRHLLLPHGIWGLRCNRGHRASGKKELREKMPFHHVTAGLLYKGNYLNRSLSAGSDSEQLAN 87

  Fly    78 KFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIEEIDSDGSGT 142
            ..:.|.|      |:|||||:.|:.|||||....|...::.|....:|.||.|:::.:|.||.|.
Mouse    88 ISVEELD------EIREAFRVLDRDGNGFISKQELGMAMRSLGYMPSEVELAIIMQRLDMDGDGQ 146

  Fly   143 VDFDEFMEMM 152
            |||||||.::
Mouse   147 VDFDEFMTIL 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 44/140 (31%)
Caln1XP_006504429.3 PTZ00184 87..>197 CDD:185504 31/76 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.