DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and AgaP_AGAP006181

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_316246.4 Gene:AgaP_AGAP006181 / 1276848 VectorBaseID:AGAP006181 Length:154 Species:Anopheles gambiae


Alignment Length:150 Identity:79/150 - (52%)
Similarity:115/150 - (76%) Gaps:1/150 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGRLEFGE 71
            :|:.:|:.:|:::|.:||.:|.|||..|:|..||.|:||...::.|:|::||.|.|:||::||.|
Mosquito     5 ELSKDQMKILKESFEAFDIEKKGSISVEVVGTILELLGQTLSEEELKEVMEEYDVDESGQIEFDE 69

  Fly    72 FVQLAAKFI-VEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIEEI 135
            |::||:.|: .|||.:|::.||||.|.:|||.|.||||....|:||:|||..:.|.|||.:|:||
Mosquito    70 FLELASNFVEPEEDYDALRAELREVFMMYDKNGTGFIPLDVFKKILQELDGAVPENELDDIIDEI 134

  Fly   136 DSDGSGTVDFDEFMEMMTGE 155
            |:||||||||:||||:||||
Mosquito   135 DADGSGTVDFEEFMEVMTGE 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 75/146 (51%)
AgaP_AGAP006181XP_316246.4 FRQ1 1..154 CDD:227455 77/148 (52%)
EFh 14..75 CDD:298682 28/60 (47%)
EFh 90..152 CDD:238008 39/61 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 1 1.000 - - FOG0001548
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.