DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and AgaP_AGAP006179

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_001688814.1 Gene:AgaP_AGAP006179 / 1276847 VectorBaseID:AGAP006179 Length:187 Species:Anopheles gambiae


Alignment Length:152 Identity:102/152 - (67%)
Similarity:125/152 - (82%) Gaps:1/152 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SVDEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGRL 67
            ||| ||...|:.:|:.|||:||.:|.|.|.|:||..||.::|...|.|:|:|:|:|||.|.||.|
Mosquito    34 SVD-DLDKAQLELLRNAFNAFDQEKKGCIGTQMVGTILSMLGHQLDDKMLKEIIDEVDADGSGEL 97

  Fly    68 EFGEFVQLAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMI 132
            ||.|||.|||:|:|||||||||:||:||||||||:|||:|.|..|:||||||||.||.::||:||
Mosquito    98 EFEEFVTLAARFMVEEDAEAMQQELKEAFRLYDKEGNGYITTQVLREILKELDDNLTNEDLDMMI 162

  Fly   133 EEIDSDGSGTVDFDEFMEMMTG 154
            ||||||||||||||||||:|||
Mosquito   163 EEIDSDGSGTVDFDEFMEVMTG 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 96/146 (66%)
AgaP_AGAP006179XP_001688814.1 PTZ00184 34..183 CDD:185504 99/149 (66%)
EFh 46..107 CDD:238008 33/60 (55%)
EFh 121..183 CDD:238008 48/61 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28890
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 1 1.000 - - FOG0001548
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X7638
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.