DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and AgaP_AGAP002536

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_312402.5 Gene:AgaP_AGAP002536 / 1273426 VectorBaseID:AGAP002536 Length:285 Species:Anopheles gambiae


Alignment Length:151 Identity:53/151 - (35%)
Similarity:91/151 - (60%) Gaps:4/151 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGRLEFGEF 72
            ::..|:...::||..||....|||..|.:..::|.:||....:.|:|::.|:|.|..|.:.|.||
Mosquito   111 ISKNQMKEFREAFRLFDKDNDGSITKEELGTVMRSLGQFARVEELQEMLLEIDVDGDGNVSFEEF 175

  Fly    73 VQLAAKF---IVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIEE 134
            |.:.:..   :.|..|:..::|||:|||::||...|:|..:.|:.:|:.|.:.|.|:|::.||:|
Mosquito   176 VDIMSNMTDTVAETSADQEERELRDAFRVFDKHNRGYITASDLRAVLQCLGEDLDEEEIEDMIKE 240

  Fly   135 IDSDGSGTVDFDEFMEMMTGE 155
            :|.||.|.:||.||:..: ||
Mosquito   241 VDVDGDGRIDFYEFVHAL-GE 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 51/147 (35%)
AgaP_AGAP002536XP_312402.5 PTZ00184 111..255 CDD:185504 50/143 (35%)
EFh 118..180 CDD:238008 21/61 (34%)
EFh 197..258 CDD:238008 27/60 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.