DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and AgaP_AGAP009330

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_310000.4 Gene:AgaP_AGAP009330 / 1271259 VectorBaseID:AGAP009330 Length:155 Species:Anopheles gambiae


Alignment Length:152 Identity:87/152 - (57%)
Similarity:118/152 - (77%) Gaps:4/152 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGRLEF 69
            ||:   :::.:::|||..||.||||.|.|..::.||..|||.||:..|::||:|.|.:.:||:.|
Mosquito     7 DEE---QRMLIMRKAFQMFDTQKTGFIETIKISTILNTMGQLFDEGELQDLIDEEDPESTGRVNF 68

  Fly    70 GEFVQLAAKFI-VEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIE 133
            ..|..:|:.|: .||||||||:||:|||||||::|||:|.|:.||||||.|||:|:.::||.:|.
Mosquito    69 DGFANIASNFLQEEEDAEAMQQELKEAFRLYDREGNGYITTSTLKEILKALDDKLSSEDLDGIIG 133

  Fly   134 EIDSDGSGTVDFDEFMEMMTGE 155
            |||:||||||||||||||||||
Mosquito   134 EIDTDGSGTVDFDEFMEMMTGE 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 82/147 (56%)
AgaP_AGAP009330XP_310000.4 FRQ1 1..155 CDD:227455 85/150 (57%)
EFh 16..76 CDD:298682 27/59 (46%)
EFh 91..153 CDD:238008 44/61 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28890
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 1 1.000 - - FOG0001548
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.