DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and AgaP_AGAP007248

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_001687986.1 Gene:AgaP_AGAP007248 / 1269900 VectorBaseID:AGAP007248 Length:186 Species:Anopheles gambiae


Alignment Length:137 Identity:35/137 - (25%)
Similarity:63/137 - (45%) Gaps:22/137 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GSIPTEMVADILRLMGQPFDKKILEELIEEV----DEDKSGRLEFGEFVQLAAKFIVEEDAEAMQ 89
            |.:......|:.::.   |.....||..:.|    |.||:|.::|.||: ||   |....:...:
Mosquito    43 GKLTPAKFVDMYKMF---FPSGNAEEFCDHVFRTFDMDKNGYIDFKEFL-LA---IDVTSSGTPE 100

  Fly    90 KELREAFRLYDKQGNGFIPTTCLKEILKELDDQL-----------TEQELDIMIEEIDSDGSGTV 143
            ::|:.|||:||..|||.|....:.:|::.:.|.|           .|:....:..::|.:..|.:
Mosquito   101 EKLKWAFRMYDVDGNGVIDIQEMTKIVQAIYDMLGACSSNKPADSAEERAKNIFAKMDENNDGQL 165

  Fly   144 DFDEFME 150
            ..|||::
Mosquito   166 TQDEFLK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 35/137 (26%)
AgaP_AGAP007248XP_001687986.1 FRQ1 18..178 CDD:227455 35/137 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.