DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and AgaP_AGAP013280

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_003435726.1 Gene:AgaP_AGAP013280 / 11175605 VectorBaseID:AGAP013280 Length:184 Species:Anopheles gambiae


Alignment Length:161 Identity:41/161 - (25%)
Similarity:72/161 - (44%) Gaps:26/161 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LTPEQIAVLQKAFNSFDHQKTGSI----PTEMVADIL-RLMGQPFDKKILEELIEEVDEDKSGRL 67
            ||..:|..:.:.|...|..:..|:    |.:.|.::. :|...||..::|.....|.|:    |.
Mosquito    22 LTKSEIIFILQKFLLLDDGRNFSLTKRFPEQEVVNLFPQLKHNPFRDRLLHVFSSENDD----RF 82

  Fly    68 EFGEFVQLAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLT-----EQE 127
            .|.:.:.|   |.|..:...:..:...||::||...:..|    .||.:.||.|::|     |||
Mosquito    83 SFEDMLDL---FSVLSEKCPLAVKASWAFQIYDFDDDNLI----TKEDILELCDRITQHDRLEQE 140

  Fly   128 -----LDIMIEEIDSDGSGTVDFDEFMEMMT 153
                 .|::::|||...:|.:...||:..|:
Mosquito   141 EKMNIADLLLKEIDLQNNGNIGEFEFVHAMS 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 40/159 (25%)
AgaP_AGAP013280XP_003435726.1 FRQ1 12..174 CDD:227455 41/161 (25%)
EFh 103..171 CDD:298682 21/71 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.