DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and CETN3

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001284694.1 Gene:CETN3 / 1070 HGNCID:1868 Length:191 Species:Homo sapiens


Alignment Length:173 Identity:45/173 - (26%)
Similarity:87/173 - (50%) Gaps:27/173 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGRLEFGE 71
            :|:.||...::.||..||..|..:|....:...:|.:|....|..:.:::::.|.:.:|::.|.:
Human    21 ELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFED 85

  Fly    72 FVQLAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIEEID 136
            |.::...:|:|.|.   .:|:.:||:|:|...:|.|....|:.:.:||.:.::::||..||||.|
Human    86 FNEVVTDWILERDP---HEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFD 147

  Fly   137 SDGSG------------------------TVDFDEFMEMMTGE 155
            .||.|                        .|:.:||:.:|||:
Human   148 KDGDGEILKNILLLPIWSRCLSLNREFFSEVNQEEFIAIMTGD 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 42/169 (25%)
CETN3NP_001284694.1 PTZ00183 15..190 CDD:185503 44/171 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.