DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and CETN2

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_004335.1 Gene:CETN2 / 1069 HGNCID:1867 Length:172 Species:Homo sapiens


Alignment Length:146 Identity:50/146 - (34%)
Similarity:90/146 - (61%) Gaps:3/146 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDKKILEELIEEVDEDKSGRLEFGE 71
            :||.||...:::||:.||...||:|..:.:...:|.:|....|:.::::|.|:|::.:|::.||:
Human    24 ELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGD 88

  Fly    72 FVQLAAKFIVEEDAEAMQKELREAFRLYDKQGNGFIPTTCLKEILKELDDQLTEQELDIMIEEID 136
            |:.:..:.:.|:|.   ::|:.:||:|:|....|.|....||.:.|||.:.||::||..||:|.|
Human    89 FLTVMTQKMSEKDT---KEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEAD 150

  Fly   137 SDGSGTVDFDEFMEMM 152
            .||.|.|...||:.:|
Human   151 RDGDGEVSEQEFLRIM 166

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 50/146 (34%)
CETN2NP_004335.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 3/5 (60%)