DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and si:cabz01076231.1

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_021333321.1 Gene:si:cabz01076231.1 / 101886622 ZFINID:ZDB-GENE-160728-151 Length:218 Species:Danio rerio


Alignment Length:152 Identity:47/152 - (30%)
Similarity:94/152 - (61%) Gaps:4/152 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMG-QPFDKKILEELIEEVDEDKSGRLE 68
            :.:|:..::..|.:||..||:.:.|.:..:.:|:.:|.|| .|.:.::| |:|:::.....|.::
Zfish    66 ERELSQPELDELAEAFKEFDYDQDGYLNYKDLAECMRTMGYMPTEMELL-EIIQQIKMRLGGLMD 129

  Fly    69 FGEFVQLAAKFIVEEDAEAM-QKELREAFRLYDKQGNGFIPTTCLKEILKE-LDDQLTEQELDIM 131
            |.:|.:|....::.|.|:.: .||::.:|..:|..|:|.|....:||.:|. |.::|.:.||:.:
Zfish   130 FDDFCELMGPRMMVETADMLGLKEIKSSFCQFDTDGDGKISVDEMKEAVKNLLGEKLKKGELEEI 194

  Fly   132 IEEIDSDGSGTVDFDEFMEMMT 153
            ::|:|.:|.||||||||:.|::
Zfish   195 LKELDLNGDGTVDFDEFVMMLS 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 47/149 (32%)
si:cabz01076231.1XP_021333321.1 EFh_PEF 68..215 CDD:330173 46/147 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.