DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC73F and neil2

DIOPT Version :9

Sequence 1:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001107382.1 Gene:neil2 / 100135209 XenbaseID:XB-GENE-1000519 Length:313 Species:Xenopus tropicalis


Alignment Length:100 Identity:20/100 - (20%)
Similarity:38/100 - (38%) Gaps:36/100 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TEMVADILRLMGQPFDKKILEE---------LIEEVDEDKSGRLEFGEFVQLAAKFIVEEDAEAM 88
            |:.|.:|  |.|....|:.:::         :|:...|:.|..|:..::.::           .|
 Frog    58 TKAVGNI--LSGTEDAKEHIDQAGGSQKDYSIIQPTSEEHSESLQDADYSEI-----------HM 109

  Fly    89 QKELREAFRLY--------------DKQGNGFIPT 109
            .:.||..|.||              :|:|:...||
 Frog   110 SRWLRFHFGLYGSVRSNEFARAKQANKRGDWRDPT 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 19/99 (19%)
neil2NP_001107382.1 Nei 1..302 CDD:223344 19/99 (19%)
MeNeil2_N 1..167 CDD:176802 19/99 (19%)
H2TH 177..>242 CDD:284294
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165167889
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.