DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pop5 and POP5

DIOPT Version :9

Sequence 1:NP_648955.1 Gene:Pop5 / 39915 FlyBaseID:FBgn0036696 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_009369.1 Gene:POP5 / 851200 SGDID:S000000031 Length:173 Species:Saccharomyces cerevisiae


Alignment Length:140 Identity:37/140 - (26%)
Similarity:64/140 - (45%) Gaps:22/140 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRIKNRYIAVQIVPYTPTQS----------LRLNDHSLT------KILLQNVEK----YYGVYG 45
            |||:|:|||..:|: :.||.:          :.|:.|..:      |.:||.:.:    ..|.||
Yeast     1 MVRLKSRYILFEII-FPPTDTNVEESVSKADILLSHHRASPADVSIKSILQEIRRSLSLNLGDYG 64

  Fly    46 LAVIEQGFRVKYINDRTKMAIIRCLHRGQRFVSSVLPLITLIGDVRAKF-RTLYIGATIIQCNKF 109
            .|......::||.:::|...||||.......|...|.|::.||||.... ..:.:..||.:..:|
Yeast    65 SAKCNSLLQLKYFSNKTSTGIIRCHREDCDLVIMALMLMSKIGDVDGLIVNPVKVSGTIKKIEQF 129

  Fly   110 IVKHQKQFLD 119
            .::...:.|:
Yeast   130 AMRRNSKILN 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pop5NP_648955.1 RNase_P_Rpp14 7..111 CDD:280137 32/124 (26%)
POP5NP_009369.1 POP5 4..141 CDD:224288 34/137 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1369
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I1879
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005209
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103583
Panther 1 1.100 - - LDO PTHR10993
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R950
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.850

Return to query results.
Submit another query.