DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pop5 and EMB1687

DIOPT Version :9

Sequence 1:NP_648955.1 Gene:Pop5 / 39915 FlyBaseID:FBgn0036696 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_683274.1 Gene:EMB1687 / 839460 AraportID:AT1G04635 Length:151 Species:Arabidopsis thaliana


Alignment Length:139 Identity:36/139 - (25%)
Similarity:61/139 - (43%) Gaps:8/139 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRIKNRYIAVQIVPYTPTQSLR-------LNDHSLTKILLQNVEKYYGVYGLAVIEQGFRVKYI 58
            ||..||||:.:::. ..|.:.|.       |...:|:|.:..::...:|..||......|:|||:
plant     1 MVGFKNRYMLMEVF-LDPDKDLLGEGTPIILTQFNLSKAIKDSILVNFGECGLGSSLGSFQVKYV 64

  Fly    59 NDRTKMAIIRCLHRGQRFVSSVLPLITLIGDVRAKFRTLYIGATIIQCNKFIVKHQKQFLDRTMG 123
            |..||:.|:|......|.|...:.|:..||:.......|.|...|..|....:|..|:..::...
plant    65 NPITKLCIVRSSREEHRQVWLAITLVKSIGNCPVILNLLDISGCIRACRDTALKCDKEKFEQCSK 129

  Fly   124 QITSAKERQ 132
            .::..:.||
plant   130 SLSEEEIRQ 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pop5NP_648955.1 RNase_P_Rpp14 7..111 CDD:280137 28/110 (25%)
EMB1687NP_683274.1 RNase_P_Rpp14 7..117 CDD:396467 28/110 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1369
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I2662
OMA 1 1.010 - - QHG54918
OrthoDB 1 1.010 - - D1492689at2759
OrthoFinder 1 1.000 - - FOG0005209
OrthoInspector 1 1.000 - - oto3818
orthoMCL 1 0.900 - - OOG6_103583
Panther 1 1.100 - - LDO PTHR10993
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.840

Return to query results.
Submit another query.