DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pop5 and pop5

DIOPT Version :9

Sequence 1:NP_648955.1 Gene:Pop5 / 39915 FlyBaseID:FBgn0036696 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001013566.1 Gene:pop5 / 541421 ZFINID:ZDB-GENE-050320-123 Length:169 Species:Danio rerio


Alignment Length:150 Identity:47/150 - (31%)
Similarity:77/150 - (51%) Gaps:6/150 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRIKNRYIAVQIVPYTPTQSLRLNDHSLTKILLQNVEKYYGVYGLAV--IEQGFRVKYINDRTK 63
            |||.|:||:..::....|:......|..:.:.|...|.:.:|.||.|:  |..|..|||:|..|.
Zfish     1 MVRFKSRYLLCELCVSEPSSLHLFEDKVVYQALRGAVNRAHGDYGAAIFNITLGVLVKYLNAHTG 65

  Fly    64 MAIIRCLHRGQRFVSSVLPLITLIGD----VRAKFRTLYIGATIIQCNKFIVKHQKQFLDRTMGQ 124
            :.:|||.....|.|.|.||.||.:.:    ||..|..:::|.||....||::|:.:|.|.|.:..
Zfish    66 VVLIRCRKAHYRLVWSSLPFITFLENRGQKVRCFFNCIHVGGTIRTSQKFLIKYNRQQLQRMLLD 130

  Fly   125 ITSAKERQDLFKRVMEFDMD 144
            ..:..|:||:.|.::...::
Zfish   131 CKTDAEKQDVRKAILSCSLN 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pop5NP_648955.1 RNase_P_Rpp14 7..111 CDD:280137 35/109 (32%)
pop5NP_001013566.1 RNase_P_Rpp14 7..117 CDD:280137 35/109 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594629
Domainoid 1 1.000 52 1.000 Domainoid score I11548
eggNOG 1 0.900 - - E1_COG1369
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5260
OMA 1 1.010 - - QHG54918
OrthoDB 1 1.010 - - D1492689at2759
OrthoFinder 1 1.000 - - FOG0005209
OrthoInspector 1 1.000 - - oto39389
orthoMCL 1 0.900 - - OOG6_103583
Panther 1 1.100 - - LDO PTHR10993
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R950
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.