DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pop5 and CG9804

DIOPT Version :9

Sequence 1:NP_648955.1 Gene:Pop5 / 39915 FlyBaseID:FBgn0036696 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001303459.1 Gene:CG9804 / 40565 FlyBaseID:FBgn0037251 Length:234 Species:Drosophila melanogaster


Alignment Length:108 Identity:24/108 - (22%)
Similarity:43/108 - (39%) Gaps:20/108 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ILLQNVEKYYGVYGLAVIEQGFRVKYINDRTKMAIIRC---LHRGQRFVSSVLPLITLIGDVR-A 92
            ::||..:..|.|        |.|.|....:.:..:.|.   .||..|.     .|||..|..: .
  Fly    45 LVLQEHDPVYTV--------GLRTKDYTAQDEDRLRRLGADFHRTDRG-----GLITFHGPGQLV 96

  Fly    93 KFRTLYIGATIIQCNKFIVKHQKQFLD--RTMGQITSAKERQD 133
            .:..|::|..:.....::...::..::  ..|| |:|||..:|
  Fly    97 AYPILHLGQFVPSIRWYVATLERMVVEACHQMG-ISSAKATKD 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pop5NP_648955.1 RNase_P_Rpp14 7..111 CDD:280137 17/82 (21%)
CG9804NP_001303459.1 BPL_LplA_LipB 1..216 CDD:301309 24/108 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10993
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.