DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pop5 and Pop5

DIOPT Version :9

Sequence 1:NP_648955.1 Gene:Pop5 / 39915 FlyBaseID:FBgn0036696 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001099222.2 Gene:Pop5 / 117241 RGDID:1311819 Length:169 Species:Rattus norvegicus


Alignment Length:142 Identity:44/142 - (30%)
Similarity:75/142 - (52%) Gaps:4/142 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRIKNRYIAVQIVPYTPTQSLRLNDHSLTKILLQNVEKYYGVYGLAVIEQGFRVKYINDRTKMA 65
            |||.|:||:..::|...|...|.|:|..|..::...:.:.:|.:|.|....||.|:|:|..|.:.
  Rat     1 MVRFKHRYLLCELVSEDPRCRLSLDDRVLGGLVRDTIARVHGAFGAAACSVGFAVRYLNAYTGVV 65

  Fly    66 IIRCLHRGQRFVSSVLPLITLIGDVRAK----FRTLYIGATIIQCNKFIVKHQKQFLDRTMGQIT 126
            ::||.....:.|.|.||.||.:.:...:    |.||::|.||..|.||::::.::.|...:...|
  Rat    66 LLRCRKDFYQLVWSALPFITCLENKGHRYSCFFNTLHVGGTIRTCQKFLIQYNRRQLLVLLQNYT 130

  Fly   127 SAKERQDLFKRV 138
            ...||:.:.|.|
  Rat   131 DEGEREAIKKSV 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pop5NP_648955.1 RNase_P_Rpp14 7..111 CDD:280137 34/107 (32%)
Pop5NP_001099222.2 RNase_P_Rpp14 7..115 CDD:280137 34/111 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352685
Domainoid 1 1.000 63 1.000 Domainoid score I10044
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5136
OMA 1 1.010 - - QHG54918
OrthoDB 1 1.010 - - D1492689at2759
OrthoFinder 1 1.000 - - FOG0005209
OrthoInspector 1 1.000 - - oto98182
orthoMCL 1 0.900 - - OOG6_103583
Panther 1 1.100 - - LDO PTHR10993
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.870

Return to query results.
Submit another query.