DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pop5 and Pop5

DIOPT Version :9

Sequence 1:NP_648955.1 Gene:Pop5 / 39915 FlyBaseID:FBgn0036696 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_080674.1 Gene:Pop5 / 117109 MGIID:2151221 Length:169 Species:Mus musculus


Alignment Length:142 Identity:43/142 - (30%)
Similarity:74/142 - (52%) Gaps:4/142 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRIKNRYIAVQIVPYTPTQSLRLNDHSLTKILLQNVEKYYGVYGLAVIEQGFRVKYINDRTKMA 65
            |||.|:||:..::|.......|.|:|..|..::...:.:.:|.:|.|....||.|:|:|..|.:.
Mouse     1 MVRFKHRYLLCELVSEDARCRLSLDDRVLGGLVRDTIARVHGAFGAAACSVGFAVRYLNAYTGVV 65

  Fly    66 IIRCLHRGQRFVSSVLPLITLIGDVRAK----FRTLYIGATIIQCNKFIVKHQKQFLDRTMGQIT 126
            ::||.....:.|.|.||.||.:.:...:    |.||::|.||..|.||::::.::.|...:...|
Mouse    66 LLRCRKDFYQLVWSALPFITYLENKGHRYPCFFNTLHVGGTIRTCQKFLIQYNRRQLLILLQNCT 130

  Fly   127 SAKERQDLFKRV 138
            ...||:.:.|.|
Mouse   131 DEGEREAIKKSV 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pop5NP_648955.1 RNase_P_Rpp14 7..111 CDD:280137 33/107 (31%)
Pop5NP_080674.1 RNase_P_Rpp14 7..115 CDD:396467 33/111 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849075
Domainoid 1 1.000 60 1.000 Domainoid score I10588
eggNOG 1 0.900 - - E1_COG1369
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 1 0.950 - 0 Normalized mean entropy S7724
OMA 1 1.010 - - QHG54918
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005209
OrthoInspector 1 1.000 - - oto94675
orthoMCL 1 0.900 - - OOG6_103583
Panther 1 1.100 - - LDO PTHR10993
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R950
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.740

Return to query results.
Submit another query.