DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and YPL264C

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_015059.1 Gene:YPL264C / 855864 SGDID:S000006185 Length:353 Species:Saccharomyces cerevisiae


Alignment Length:285 Identity:56/285 - (19%)
Similarity:105/285 - (36%) Gaps:52/285 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 WNIEPEPRC----IPMRTYLILAALTLGTMGLSNS--SLGYLNYPTQVIFKCCKLIPVLVGSILI 183
            ||.:..|..    .|.|.:|||..: :|..|:...  ||.||:....|:.........:..|.|:
Yeast    72 WNKQSVPDIPWGPAPCRKWLILRGI-MGFFGVFGMYFSLMYLSISDAVLITFMSPTLTIFLSFLL 135

  Fly   184 QGKRYGLLDFAAATCMCIGLA-----WFTLAD---SQMTP-----------------NFNLLGVA 223
            .|:.:..|:...:.....|:.     .|...:   .|.:|                 ..:||||.
Yeast   136 LGEPFSKLEALGSLISFSGVVLIIRPTFLFGEQTQGQQSPQDDIVETQNPKLRLIAIGVSLLGVC 200

  Fly   224 MISGALLCDAAIGNVQEKAMREFKAPSSEVVFYSYGLGFVYLFVIMLVTGNFFSGFAFCLEHPVE 288
            .:|...:....|||.....|        .|.::|.....|....::|:     ...:..|.|..:
Yeast   201 GLSSVYIIIRYIGNKAHAIM--------SVSYFSLVTTVVAALGVLLI-----PSMSLQLPHSWK 252

  Fly   289 TFGYGFLFSLSGYLGIQFVLAL-VRSSGAPIAATVTTARKAVTIAFSFVLFSKPFTLQYLWSGLI 352
            .:|......:||::. |.:|.: ::...|...:.:|..:....:.:..|||.. :...:.|.|:.
Yeast   253 QWGLFLNLGISGFIH-QILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVLFHH-WPNIWTWCGMA 315

  Fly   353 VVLGIYLNVY----SKRNKLTLADV 373
            |::...:.|.    ||:|.:..|::
Yeast   316 VIVSSTIWVINMRASKQNVVATAEL 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 52/274 (19%)
EamA 219..362 CDD:279264 28/143 (20%)
YPL264CNP_015059.1 RhaT 15..325 CDD:223769 51/268 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.