DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and YML018C

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_013694.1 Gene:YML018C / 854990 SGDID:S000004480 Length:393 Species:Saccharomyces cerevisiae


Alignment Length:397 Identity:85/397 - (21%)
Similarity:149/397 - (37%) Gaps:95/397 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 DLTYYN-RTTQFLLSCAGVFFLYILYGYLQELIFTVEGF-KPYGWFLTLVQ---FGYYIGFGLVE 111
            |.|.:| |.|..||....|..|::|..:|..|||..:.: ||:  |:|...   |.:|: |...:
Yeast     5 DQTSFNKRWTLGLLMLGLVIILWVLSSFLINLIFEDDSYRKPF--FITYTNTAAFIFYL-FPTAK 66

  Fly   112 RRLEGYRISGGSFWNIEPE------------PRCIPMRTYLILAALTLGTMG------------- 151
            ..:..|:.:|.:  |:..|            .|.:.| |..:|..|..||..             
Yeast    67 AVVVNYKDTGRA--NVHRELIMEEEGTGSDSNRSVDM-TSPLLTNLEAGTHANQKKRLTLYETIK 128

  Fly   152 --------------LSNSSLGYLNYPTQVIFK-CCKLIPVLVGSI-----LIQGKRYG-LLDFAA 195
                          ::|:||.:.:..:|.|.. ......:.:|:|     |.:.|..| .:.|  
Yeast   129 LSAEFCILWFTANLVTNASLAFTSVASQTILSTTSSFFTLFIGAICHVESLSKSKVLGSFISF-- 191

  Fly   196 ATCMCIGLAWFTLADSQMTPNFNLLGVA---------MISGAL-LCDAAIGNVQEKAMREFKAPS 250
                 :|:...|.:||......::..|:         :|...| |..|.:..|....::......
Yeast   192 -----VGIIMVTKSDSHQRYQRHIADVSGDDNDAVQVLIGNLLALAGAVLYGVYSTLLKREVGDE 251

  Fly   251 SEV---VFYSYGLGFVYLFVIM-----LVTGNFFSGFAFCLEHPVETFGYGFLFSLSGYLGIQFV 307
            :.|   :|:    |||.||.::     |:..:||....|.|....:.....|:..|..::. .|.
Yeast   252 TRVNMKIFF----GFVGLFNLLFLWPSLIVLDFFGWEPFSLPKDPKVVVIIFVNCLITFVS-DFC 311

  Fly   308 LALVRSSGAPIAATVTTARKAVTIAFSFVLFS-KPFTLQYLWSGLIVVLGIY--LNVYSK----R 365
            .|......:|:..||..:.......|..|:|. |..:..||: |..::||.:  :|..|:    .
Yeast   312 WAKAMLLTSPLTVTVGLSITIPLAMFGDVIFKHKTMSALYLF-GATLILGSFFIINKSSEEEHFE 375

  Fly   366 NKLTLAD 372
            |.:|.::
Yeast   376 NSITASN 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 77/373 (21%)
EamA 219..362 CDD:279264 35/163 (21%)
YML018CNP_013694.1 RhaT <142..367 CDD:223769 49/237 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.