DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and YMD8

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_013674.1 Gene:YMD8 / 854970 SGDID:S000004502 Length:442 Species:Saccharomyces cerevisiae


Alignment Length:426 Identity:83/426 - (19%)
Similarity:147/426 - (34%) Gaps:116/426 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 NRTTQFLLSCAGVFFLYILYGYLQELIFTVEGFKPYGWFLTLVQF---------GYYIGFGLVER 112
            |||. ||....|.:|..|........:|..:.....|:.:.:..|         |.||  .|..:
Yeast     2 NRTV-FLAFVFGWYFCSIALSIYNRWMFDPKDGLGIGYPVLVTTFHQATLWLLSGIYI--KLRHK 63

  Fly   113 RLEG-YRISGGSFWNIEPEPRCIPMRTYLILAALTLGTMGLSNSSLGYLNYPTQVIFKCCKLIPV 176
            .::. .|.:.|..|:..       ::..|..|..:.|.:||||.|..|:......|.|...:..|
Yeast    64 PVKNVLRKNNGFNWSFF-------LKFLLPTAVASAGDIGLSNVSFQYVPLTIYTIIKSSSIAFV 121

  Fly   177 LVGSILIQGKRYGLLDFAAATCMCIGLAW--FTLADSQMTPNFNLLGVAMISGALL-----CDAA 234
            |:...:.:.:::......:...|.:|:|.  |..:||..|.|...|   :|.|:.|     |.:.
Yeast   122 LLFGCIFKLEKFHWKLALSVIIMFVGVALMVFKPSDSTSTKNDQAL---VIFGSFLVLASSCLSG 183

  Fly   235 IGNVQEKAM---REFKAPSSEVVFYSYGLGFVYLF-----------VIMLVTGNFFSGFAFCLEH 285
            :..|..:.|   ...:..::..|..|.|.    ||           |:.|........|.....|
Yeast   184 LRWVYTQLMLRNNPIQTNTAAAVEESDGA----LFTENEDNVDNEPVVNLANNKMLENFGESKPH 244

  Fly   286 PVETF--------------------GYGFLFSLS--------GYLGIQ-FVLALVRS-------- 313
            |:.|.                    .:..:||.|        |.:|.: .||::||.        
Yeast   245 PIHTIHQLAPIMGITLLLTSLLVEKPFPGIFSSSIFRLDTSNGGVGTETTVLSIVRGIVLLILPG 309

  Fly   314 --------------SGAPI--AATVTTARKAVTIAFSFVLFSKPFTLQYLWSGLIVVLG--IYLN 360
                          ...|:  .:.|...::.:|:.|..::.|:..:..|.|.|:::::.  .|.|
Yeast   310 FAVFLLTICEFSILEQTPVLTVSIVGIVKELLTVIFGIIILSERLSGFYNWLGMLIIMADVCYYN 374

  Fly   361 VY-------SKRNKLTLADVRQRIK------QFGAK 383
            .:       .|.:.::..|.|..:|      |.|:|
Yeast   375 YFRYKQDLLQKYHSVSTQDNRNELKGFQDFEQLGSK 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 73/395 (18%)
EamA 219..362 CDD:279264 37/216 (17%)
YMD8NP_013674.1 TPT_S35C2 77..371 CDD:411044 57/307 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.