DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and SLC35F5

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001317244.1 Gene:SLC35F5 / 80255 HGNCID:23617 Length:536 Species:Homo sapiens


Alignment Length:211 Identity:49/211 - (23%)
Similarity:86/211 - (40%) Gaps:36/211 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 FKCCKLIPVLVGSILIQGKRYGLLDFAAATCMCIGLAWFTLADSQMTPNFNLLG-VAMISGALLC 231
            |...||:.|:: .:..:|..|.:|:|..      |:....||.|:.....:.:| :..::||:|.
Human   296 FTLSKLLAVIL-RLDKEGNGYKILNFIG------GVVLVNLAGSEKPAGRDTVGSIWSLAGAMLY 353

  Fly   232 DAAIGNVQEKAMREFKAPSSEVVFYSYGLGFVYLFVIMLVTGNFF----SGFAFCLEHP------ 286
            ...|..::.|..||.|.   ::..:   .|||.||.::|:...||    :||. ..|.|      
Human   354 AVYIVMIKRKVDREDKL---DIPMF---FGFVGLFNLLLLWPGFFLLHYTGFE-DFEFPNKVVLM 411

  Fly   287 -------VETFGYGFLFSLSGYLGIQFVLALVRSSGAPIAATVTTARKAVTIAFSFVLFSKPFTL 344
                   :.|....||:....:|....:..|..|...|::.......:.|  .||::.|:.  .:
Human   412 CIIINGLIGTVLSEFLWLWGCFLTSSLIGTLALSLTIPLSIIADMCMQKV--QFSWLFFAG--AI 472

  Fly   345 QYLWSGLIVVLGIYLN 360
            ...:|..||.|..:.|
Human   473 PVFFSFFIVTLLCHYN 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 49/211 (23%)
EamA 219..362 CDD:279264 37/160 (23%)
SLC35F5NP_001317244.1 RhaT <245..483 CDD:223769 47/204 (23%)
EamA 342..483 CDD:279264 35/151 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.