DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and Slc35f5

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001343223.1 Gene:Slc35f5 / 74150 MGIID:1921400 Length:546 Species:Mus musculus


Alignment Length:405 Identity:80/405 - (19%)
Similarity:131/405 - (32%) Gaps:121/405 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 TYYNRTTQFLLSCAGVFFLYILYGYL------QELIFTVEGF--KPYGWFLTLVQFGYYIG---- 106
            |.||:......:...:|.||:| |::      |:   ...||  ||..:|....  ||:..    
Mouse   117 TQYNKPFFSTFAKTSMFVLYLL-GFIIWKPWRQQ---CTRGFRGKPAAFFADAE--GYFAACTTD 175

  Fly   107 -----------------FGLVERRLEGYRISGGSFWNIEPEPRCIPMRTYLILAALTLGTMGLSN 154
                             ..|...:||...|      ..|..|:...:|...|:....|.:.....
Mouse   176 TSMSSSLSEPLYVPVKFHDLPSEKLESTNI------GTEKTPKKSRVRFSNIMEIRQLPSSHALE 234

  Fly   155 SSLGYLNYPT----QVIFKCC-KLIPVLVGSI--------------------------------- 181
            :.|..::|||    :.|.|.. ||....|..|                                 
Mouse   235 AKLSRMSYPTVKDQESILKTVGKLTATQVAKISFFFCFVWFLANLSYQEALSDTQVAIVNILSST 299

  Fly   182 -----LI--------QGKRYGLLDFAAATCMCIGLAWFTLADSQMTPNFNLLG-VAMISGALLCD 232
                 ||        .|.|:.|....|......|:....|:.|:.:...:.:| :..::||:...
Mouse   300 SGLFTLILAAVFPSNSGDRFTLSKLLAVILSIGGVVLVNLSGSEKSAGRDTIGSIWSLAGAMFYA 364

  Fly   233 AAIGNVQEKAMREFKAPSSEVVFYSYGLGFVYLFVIMLVTGNFF----SGFAFCLEHP------- 286
            ..|..::.|..||.|.   ::..:   .|||.||.::|:...||    :||. ..|.|       
Mouse   365 VYIVMIKRKVDREDKL---DIPMF---FGFVGLFNLLLLWPGFFLLHYTGFE-DFEFPNKVVLLC 422

  Fly   287 ------VETFGYGFLFSLSGYLGIQFVLALVRSSGAPIAATVTTARKAVTIAFSFVLFSKPFTLQ 345
                  :.|....||:....:|....:..|..|...|::.......:.|  .||::.|:.  .:.
Mouse   423 IIINGLIGTVLSEFLWLWGCFLTSSLIGTLALSLTIPLSIIADMCMQKV--QFSWLFFAG--AIP 483

  Fly   346 YLWSGLIVVLGIYLN 360
            ..:|..||.|..:.|
Mouse   484 VFFSFFIVTLLCHYN 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 77/398 (19%)
EamA 219..362 CDD:279264 36/160 (23%)
Slc35f5NP_001343223.1 RhaT <268..493 CDD:223769 43/235 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.