DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and SLC35A2

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001269580.1 Gene:SLC35A2 / 7355 HGNCID:11022 Length:421 Species:Homo sapiens


Alignment Length:288 Identity:60/288 - (20%)
Similarity:98/288 - (34%) Gaps:86/288 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 FDLTYYNRTTQFLLSCAGVFFLYILYGYLQELIFTVEGFKPYGWFLTLVQFGYYIGFGLVERRLE 115
            |.:||     |..:....:|.:.:|...|..|          .|...|:.|   .|..:|:.:..
Human   169 FQVTY-----QLKILTTALFSVLMLNRSLSRL----------QWASLLLLF---TGVAIVQAQQA 215

  Fly   116 GYRISGGSFWNIEPEPRCIPMRTYLILAALTLGTMGLSNSSLGYLNYPTQVIFKCCKLIPVLVGS 180
            |    ||.       ||.:.......|||:....:     |.|:..    |.|:  |::....||
Human   216 G----GGG-------PRPLDQNPGAGLAAVVASCL-----SSGFAG----VYFE--KILKGSSGS 258

  Fly   181 ILIQGKRYGLLDFAAATCMCIGLAWFTLADSQMTPNFNLLGVAMISGALLCDAAIGNVQEKAMRE 245
            :.::..:.||...|..   .:||.|..             |.|:                 |.|.
Human   259 VWLRNLQLGLFGTALG---LVGLWWAE-------------GTAV-----------------ATRG 290

  Fly   246 F---KAPSSEVVFYSYGLGFVYLFVIMLVTGNFFSGFAFCLEHPVETFG----YGF----LFSLS 299
            |   ..|:...|..:...|.:.:.|::....|...|||..|...:.|..    :||    ||:|.
Human   291 FFFGYTPAVWGVVLNQAFGGLLVAVVVKYADNILKGFATSLSIVLSTVASIRLFGFHVDPLFALG 355

  Fly   300 G--YLGIQFVLALVRSSGAPIAATVTTA 325
            .  .:|..::.:|.|.:...||:...:|
Human   356 AGLVIGAVYLYSLPRGAAKAIASASASA 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 57/278 (21%)
EamA 219..362 CDD:279264 26/120 (22%)
SLC35A2NP_001269580.1 Nuc_sug_transp 59..367 CDD:282054 55/270 (20%)
nst 142..366 CDD:129885 55/269 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.