DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and Slc35f2

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_006511523.1 Gene:Slc35f2 / 72022 MGIID:1919272 Length:430 Species:Mus musculus


Alignment Length:331 Identity:73/331 - (22%)
Similarity:119/331 - (35%) Gaps:94/331 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 WFLTL--------VQFGYYI-----GFGLVERRL-EGYRISG---GSFWNIEPEPRCIPMRTYLI 141
            |.||:        :..|..:     |..:..:.| |.||::.   .||.|.     |:....|.:
Mouse    85 WSLTMPLWDILKTIALGQMLSLCICGTAITSQYLAEKYRVNTPMLQSFINY-----CLLFLVYTL 144

  Fly   142 LAALTLGT----------------MGLSNSSLGYL-----NYP--TQVIFKCCKLIPVLVG-SIL 182
            :.|...|:                :||::....||     .|.  |.|....|..||||:. |..
Mouse   145 MLAFQSGSDNLLEILRRKWWKYTLLGLADVEANYLIVRAYQYTTLTSVQLLDCFGIPVLMALSWF 209

  Fly   183 IQGKRYGLLDFAAATCMCIGLAWFTLADSQMTPNFN------------LLGVAMISGALLCDAAI 235
            |...||.::.|.|.....:|:.....||.......|            |||.::.:.:.:|:..|
Mouse   210 ILRARYKVIHFIAVFVCLLGVGTMVGADILAGREDNSGSDVLIGDILVLLGASLYAVSNVCEEYI 274

  Fly   236 GNVQEKAMREFKAPSSEVVFYSYGLGFVYLFVIMLVTGNFFSGFAFCLEH--PVETFGYGFLFSL 298
              |::.:.:||             ||.|.||      |...||....:..  .:....:.:..:|
Mouse   275 --VKKLSRQEF-------------LGMVGLF------GTIISGIQLLIVEYKDIARIQWDWKIAL 318

  Fly   299 SGYLGIQFVLAL-VRSSGAPIAATVTTARK---AVTIAFSFVLFSKPFTLQYLWSGL------IV 353
               |.:.|.|.: ...|..|:...||:|..   .:..|..:.||...|..:|.:|||      ::
Mouse   319 ---LFVAFALCMFCLYSFMPLVIKVTSATSVNLGILTADLYSLFFGLFLFEYKFSGLYILSFTVI 380

  Fly   354 VLGIYL 359
            ::|..|
Mouse   381 MVGFIL 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 73/331 (22%)
EamA 219..362 CDD:279264 35/153 (23%)
Slc35f2XP_006511523.1 SLC35F 92..389 CDD:283644 70/324 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.