DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and slc35a3a

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001116721.1 Gene:slc35a3a / 559707 ZFINID:ZDB-GENE-081105-80 Length:328 Species:Danio rerio


Alignment Length:377 Identity:80/377 - (21%)
Similarity:131/377 - (34%) Gaps:122/377 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LRILCFDLT------YYNRTTQ----------------FL--LSCAGVFFLYILYG-------YL 79
            |.:|.|..|      .|:||.|                ||  |:|.|:.|....|.       ..
Zfish    11 LGVLVFQTTSLVLTMRYSRTLQGDGPRYLASSAVVVAEFLKILTCVGLVFKENSYSGRALSSIMR 75

  Fly    80 QELIFTVEGFKPYGWFLTLVQFGYYIGFGLVERRLEGYRISGGSFWNIEPEPRCIPMRTYLILAA 144
            ||:|     .||.......:..|.|                              .::..|:..|
Zfish    76 QEII-----HKPVETLKLAIPSGIY------------------------------TLQNNLLYVA 105

  Fly   145 LTLGTMGLSNSSLGYLNYPTQVIFKCCKLIPVLVGSILIQGKRYGLLDFAAATCMCIGLA---WF 206
            |         |:|....|  ||.:: .|::...:.|:.:.|:|.|:..:.:...:..|:|   |.
Zfish   106 L---------SNLDAATY--QVTYQ-LKILTTALFSVSMLGRRLGVYQWLSLLILMAGVAFVQWP 158

  Fly   207 T--LADSQ---MTPNFNLLGVAMISGALLCDAAIGNVQEKAMREFKAPSSEVVFYSYGL-GFVY- 264
            |  .||.|   :|.....:|:..:..|.......|...||.::|.| .|..|.....|| |.|: 
Zfish   159 TDSPADPQKEHLTAGSQFVGLVAVLVACCSSGFAGVYFEKILKETK-QSVWVRNIQLGLFGLVFG 222

  Fly   265 LFVIMLVTGNFFSGFAFCLEHPVETFGYGFLFSLSGYLGIQF-VLALVRSSGAPIAATVTTA--- 325
            :|.::...|:...      ||.:          ..||..:.: |:||....|..|||.:..|   
Zfish   223 VFGMLAYDGDRVR------EHGM----------FQGYNTLTWIVVALQALGGLVIAAVIKYADNI 271

  Fly   326 RKAVTIAFSFVLFS----------KPFTLQYLWSGLIVVLGIYLNVYSKRNK 367
            .|....:.|.:|.:          :|.::.:| ..::|::..:|  |...||
Zfish   272 LKGFATSLSIILSTLISYFLLEDFEPTSVFFL-GAILVIMATFL--YGYENK 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 71/351 (20%)
EamA 219..362 CDD:279264 34/158 (22%)
slc35a3aNP_001116721.1 Nuc_sug_transp 2..316 CDD:282054 77/371 (21%)
nst 87..315 CDD:129885 57/289 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.