DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and slc35a3b

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001017900.1 Gene:slc35a3b / 550599 ZFINID:ZDB-GENE-050417-460 Length:364 Species:Danio rerio


Alignment Length:393 Identity:84/393 - (21%)
Similarity:141/393 - (35%) Gaps:115/393 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SVITINGGESAGNSPPSQRKSSTSESPPELRILCFDLT------YYNRTTQ-----FLLSCAGVF 70
            |:.:::|...|.:...|.|....|     |.:|.|..|      .|:||..     :|.|.|.|.
Zfish    23 SLSSVSGSAEASSISTSSRLKYAS-----LGVLVFQTTTLVLTMRYSRTLHTEEPLYLASSAVVC 82

  Fly    71 --FLYILYGYLQELIFTVEGFKPYGWFLTLVQFGYYIGFGLVERRLEGYRISGGSFWNIEPEPRC 133
              .|.|:...|  |:|....|......|.|.:       .::.|.|...:::             
Zfish    83 AELLKIVACIL--LVFRDHSFSVRSLNLVLKE-------EIINRPLLTLKLA------------- 125

  Fly   134 IPMRTY-----LILAALTLGTMGLSNSSLGYLNYPTQVIFKCCKLIPVLVGSILIQGKRYGLLDF 193
            ||...|     |:..||         |:|....|  ||.:: .|::...:.|:.:.|||.|:..:
Zfish   126 IPSGIYTLQNNLLYVAL---------SNLDAATY--QVTYQ-LKILTTALFSVSMLGKRLGIYQW 178

  Fly   194 AAATCMCIGLA---WFT-----LADSQMTPNFNLLGVAMISGALLCDAAIGNVQEKAMREFKAPS 250
            .:...:.||:|   |.|     ..:..:|.:..|:|:..:..|.......|...||.::|.|   
Zfish   179 LSLVILMIGIALVQWPTEVSSSTGEKDLTASSQLIGLLAVLVACFSSGFAGVYFEKILKESK--- 240

  Fly   251 SEVVFYSYGLGFVYLFVIMLVTGNFFSGFAFCLEHPVETFGYGFLFS-----------LSGYLGI 304
            ..|...:..||   ||.::                    ||:|.:|:           ..||..:
Zfish   241 QSVWVRNIQLG---LFGLV--------------------FGFGGVFTYDRERVLENGLFQGYNNV 282

  Fly   305 QF-VLALVRSSGAPIAATVTTA-------RKAVTIAFS-----FVLFSKPFTLQYLWSGLIVVLG 356
            .: |:||....|..|||.:..|       ..:::|..|     |:|.....|..:....::|:..
Zfish   283 TWSVVALQALGGLVIAAVIKYADNILKGFATSISIILSTLISYFLLDDFDPTSVFFLGAMLVIAA 347

  Fly   357 IYL 359
            .:|
Zfish   348 TFL 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 71/343 (21%)
EamA 219..362 CDD:279264 34/165 (21%)
slc35a3bNP_001017900.1 Nuc_sug_transp 38..352 CDD:282054 81/378 (21%)
nst 123..351 CDD:129885 57/279 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.