DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and SLC35A5

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001335834.1 Gene:SLC35A5 / 55032 HGNCID:20792 Length:424 Species:Homo sapiens


Alignment Length:356 Identity:64/356 - (17%)
Similarity:122/356 - (34%) Gaps:93/356 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 FLLSCAGVFFLYILYGYLQELIFTVEGFKPYGWFLTLVQFGYYIGFGLVERRLEGYRISGGSFWN 126
            ||.....:...|:| .|||..:..:  |..:....|.:.|..     :::|||...:      | 
Human   102 FLYFLDNLIVFYVL-SYLQPAMAVI--FSNFSIITTALLFRI-----VLKRRLNWIQ------W- 151

  Fly   127 IEPEPRCIPMRTYLILAALTLGTMGLSNSSLGYLNYPTQVIFKCCKLIPVLVGSILIQGKRYGLL 191
                  ...:..:|.:.|||.||..|.::..|                         :|..:...
Human   152 ------ASLLTLFLSIVALTAGTKTLQHNLAG-------------------------RGFHHDAF 185

  Fly   192 DFAAATCM-----------CIGLAWFTLADSQMTPNFNL-----LGVAMISGALLC-DAAIGNV- 238
            ...:.:|:           |....| |..:::......:     ||:..:...:.| .:::.|: 
Human   186 FSPSNSCLLFRSECPRKDNCTAKEW-TFPEAKWNTTARVFSHIRLGMGHVLIIVQCFISSMANIY 249

  Fly   239 QEKAMREFKAPSSEVVFYSYGLGFVYLFVIMLVTGNFFSGFAFCLEHPVET------FGYG---- 293
            .||.::|....:..:...:..|   |.|      |..|:|....|:.....      |.||    
Human   250 NEKILKEGNQLTESIFIQNSKL---YFF------GILFNGLTLGLQRSNRDQIKNCGFFYGHSAF 305

  Fly   294 -----FLFSLSGYLGIQFVLALVRSSGAPIAATVTTARKAVTIAFSFVLFSKPFTLQYLWSGLIV 353
                 |:.:..| |.:.|:|..:.:....:.|.|||   .:....|.::|....:|::......|
Human   306 SVALIFVTAFQG-LSVAFILKFLDNMFHVLMAQVTT---VIITTVSVLVFDFRPSLEFFLEAPSV 366

  Fly   354 VLGIYLNVYSKRNKLTLADVRQRIKQFGAKV 384
            :|.|::...||......|..::||:.....:
Human   367 LLSIFIYNASKPQVPEYAPRQERIRDLSGNL 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 59/334 (18%)
EamA 219..362 CDD:279264 32/164 (20%)
SLC35A5NP_001335834.1 Nuc_sug_transp 24..374 CDD:282054 59/331 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..424 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.