DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and SLC35F2

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_059985.2 Gene:SLC35F2 / 54733 HGNCID:23615 Length:374 Species:Homo sapiens


Alignment Length:336 Identity:73/336 - (21%)
Similarity:124/336 - (36%) Gaps:88/336 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LIFTVEGFKPYGW-FLTLVQFGYYI-----GFGLVERRL-EGYRISG---GSFWNIEPEPRCIPM 136
            |:..::| |.:.| .|..:..|..:     |..:..:.| |.|:::.   .||.|.     |:..
Human    26 LLRRIKG-KLFTWNILKTIALGQMLSLCICGTAITSQYLAERYKVNTPMLQSFINY-----CLLF 84

  Fly   137 RTYLILAALTLGT----------------MGLSNSSLGYL-----NYP--TQVIFKCCKLIPVLV 178
            ..|.::.|...|:                :||::....|:     .|.  |.|....|..||||:
Human    85 LIYTVMLAFRSGSDNLLVILKRKWWKYILLGLADVEANYVIVRAYQYTTLTSVQLLDCFGIPVLM 149

  Fly   179 G-SILIQGKRYGLLDFAAATCMCIGLAWFTLADSQMTPNFN------------LLGVAMISGALL 230
            . |..|...||.::.|.|.....:|:.....||.......|            |||.::.:.:.:
Human   150 ALSWFILHARYRVIHFIAVAVCLLGVGTMVGADILAGREDNSGSDVLIGDILVLLGASLYAISNV 214

  Fly   231 CDAAIGNVQEKAMREFKAPSSEVVFYSYGLGFVYLFVIMLVTGNFFSGFAFCLEH--PVETFGYG 293
            |:..|  |::.:.:||             ||.|.||      |...||....:..  .:.:..:.
Human   215 CEEYI--VKKLSRQEF-------------LGMVGLF------GTIISGIQLLIVEYKDIASIHWD 258

  Fly   294 FLFSLSGYLGIQFVLAL-VRSSGAPIAATVTTARK---AVTIAFSFVLFSKPFTLQYLWSGL--- 351
            :..:|   |.:.|.|.: ...|..|:...||:|..   .:..|..:.||...|...|.:|||   
Human   259 WKIAL---LFVAFALCMFCLYSFMPLVIKVTSATSVNLGILTADLYSLFVGLFLFGYKFSGLYIL 320

  Fly   352 ---IVVLGIYL 359
               ::::|..|
Human   321 SFTVIMVGFIL 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 73/336 (22%)
EamA 219..362 CDD:279264 35/153 (23%)
SLC35F2NP_059985.2 SLC35F 35..334 CDD:283644 70/326 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.