DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and Slc35f1

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001102808.1 Gene:Slc35f1 / 502421 RGDID:1559576 Length:408 Species:Rattus norvegicus


Alignment Length:317 Identity:74/317 - (23%)
Similarity:118/317 - (37%) Gaps:102/317 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LVERRLEGYRISGGSFWNIEPEPRCIPMRTYLILAALTLGTMGLSNSSLGYLNYPTQVIFKCCKL 173
            ::.||...|.|.|  |.::|        ..||::.|....|:             |.|....|.:
  Rat   124 ILRRRWWKYMILG--FIDLE--------ANYLVVKAYQYTTL-------------TSVQLLDCFV 165

  Fly   174 IPVLV----GSILIQGKRYGLLDFAAATCMCIGLAWFTLAD-----------SQMTPNFNLLGVA 223
            |||::    ..:||   ||..:.|.......:|:.....||           :::..:..:||.|
  Rat   166 IPVVILLSWFFLLI---RYKAVHFIGIVVCILGMGCMVGADVLVGRHQGAGENKLVGDLLVLGGA 227

  Fly   224 MISGALLCDAAIGNV-QEKAMREFKAPSSEVVFYSYGLGFVYLFVIMLVTGNFFSGFAFC-LEH- 285
            .:.|       |.|| :|..:|..    |.|.|    ||.:.||      |.||||.... :|| 
  Rat   228 TLYG-------ISNVWEESIIRTL----SRVEF----LGMIGLF------GAFFSGIQLAIMEHK 271

  Fly   286 ---------PVETFGYGF---LFSLSGYLGIQFVLALVRSSGAPIAATVTTARKAVTIAFSFVLF 338
                     .:.....||   :|.|..::.:     :::.:.|      |:...::..|..:.||
  Rat   272 ELLKVPWDWQIGLLYVGFSACMFGLYSFMPV-----VIKKTSA------TSVNLSLLTADLYSLF 325

  Fly   339 SKPFTLQYLWSGL------IVVLGIYLNVYSKRNKLTLADVRQRIKQFGAKVARSPS 389
            ...|...|.:|||      .:::|:.|  ||..:.....|.|. .|||     |:||
  Rat   326 CGLFLFHYKFSGLYLLSFFTILIGLVL--YSSTSTYIAQDPRV-YKQF-----RNPS 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 65/290 (22%)
EamA 219..362 CDD:279264 39/163 (24%)
Slc35f1NP_001102808.1 SLC35F 56..355 CDD:283644 65/290 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.