DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and CG14511

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_651675.1 Gene:CG14511 / 43445 FlyBaseID:FBgn0039641 Length:322 Species:Drosophila melanogaster


Alignment Length:337 Identity:80/337 - (23%)
Similarity:133/337 - (39%) Gaps:71/337 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 FLLSCAGVFFLYILYGYLQELIFTVEGFKPYGWFLTLVQFGYYIGFGLVERRLEGYRISGGSFWN 126
            ||..|:||.||        ||:..::  ...|..:|..||.:.        .|||: |....|..
  Fly    15 FLGCCSGVVFL--------ELLVKLD--PGAGNLITGAQFAFI--------ALEGF-IFTSKFGL 60

  Fly   127 IEPEPRCIPMRTYLILAALTLGTMGLSNSSLGYLNYP--TQVIFKCCKLIPVLVGSILIQGKRYG 189
            .:   |.|.:|.|.:|.|:...| .:.|:.:.....|  ..:|.:...||..:....||..:.|.
  Fly    61 AQ---RVISLRDYALLVAMFFLT-SVCNNYVFKFKVPMTLHMIIRGGSLISNMCLCTLILKRSYR 121

  Fly   190 LLDFAAATCMCIGL---AWFTLAD-----------SQMTPNFNLLGVAMISGALLCDAAIGNVQE 240
            |..:.:...:.:|:   .:|:..|           ::....:.|||||::..||...:.:|..||
  Fly   122 LSQYISVLMISVGIFVCTYFSSPDLVGKMENLDSGAEADTFWWLLGVALLVLALFVSSYMGITQE 186

  Fly   241 KAMREFKAPSSEVVFYSYGLGF-VYLFV--------IMLVTGNFFS----GFAFCLEHPVETFGY 292
            ...|.....:.|.::|::.|.. .:|.:        ::..||..:.    |.|..|         
  Fly   187 LLYRRHGKCAREALYYTHLLPLPAFLLMHDDIRTHWLLAFTGESYQLPLLGVAVPL--------- 242

  Fly   293 GFLFSLSG-----YLGIQFVLALVRSSGAPIAATVTTARKAVTIAFSFVLFSKPFTLQYLWSG-L 351
             .|..|.|     :|.|..|..|.....:.....:.|.||.:::.||.|.|..|||..: |.| .
  Fly   243 -ILLYLLGNVLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIVYFRNPFTWWH-WLGTA 305

  Fly   352 IVVLG--IYLNV 361
            :|.:|  ::.||
  Fly   306 LVFVGTLMFANV 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 80/337 (24%)
EamA 219..362 CDD:279264 43/164 (26%)
CG14511NP_651675.1 UAA 6..318 CDD:285625 80/337 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451126
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10778
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.