DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and meigo

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001097853.1 Gene:meigo / 42510 FlyBaseID:FBgn0250820 Length:338 Species:Drosophila melanogaster


Alignment Length:337 Identity:87/337 - (25%)
Similarity:145/337 - (43%) Gaps:47/337 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 TQFLLSCAGVFFLYILYGYLQELIFTVEGFKPYGWFLTLVQFGYYIGFGLVERRLEGYRISGGSF 124
            ::|::...|:|..|.|||.:||.:       ..|.:...||....:|        |.:..:....
  Fly     7 SRFVIYAVGIFVCYFLYGIVQEKL-------TRGRYGEEVQTDGSVG--------ERFTYALALV 56

  Fly   125 W--------------NIEPEPRCIPMRTYLILAALT-LGTMGLSNSSLGYLNYPTQVIFKCCKLI 174
            |              .|.|:..........:..:|| |..|..:|.::.::.|||.|:.|..|.|
  Fly    57 WVQCLCNYVFAKVLLTIRPQKEDTTNAGSYVACSLTYLLAMVSTNMAMRWVPYPTAVVGKSAKPI 121

  Fly   175 PVLVGSILIQGKRYGLLDFAAATCMCIGLAWFTLAD---SQMTPNFNLLGVAMISGALLCDAAIG 236
            ||::..:||..|.|....:|....:.:|:..|...:   |.:.....|||..::..:|..|...|
  Fly   122 PVMILGVLIGRKSYSWTRYACVLTIVLGVILFMYKEGKVSNLPAETTLLGEVLLFLSLSMDGLTG 186

  Fly   237 NVQEKAMREFKAPSSEVV-----FYSYGLGFVYLFVIMLVTGNFFSGFAFCLEHPVETFGYGFLF 296
            .|||: :|...|||.:.:     |:|    .:.|.|.|:.||.......|.:.|| |.:.:..|.
  Fly   187 AVQER-IRAASAPSGQQMMRAMNFWS----TLMLGVAMVFTGEAKEFMYFTIRHP-EAWTHLSLI 245

  Fly   297 SLSGYLGIQFVLALVRSSGAPIAATVTTARKAVTIAFSFVLFSKPFTLQYLWSGLIVVL-GIYLN 360
            ::.|.||..|:..:|.|.|....:.|||.||..|:..|.:||......:. |.|.::|. .::::
  Fly   246 AVCGVLGQFFIFLMVASFGPLACSVVTTTRKFFTVLCSVLLFGNVLIARQ-WLGAVLVFAALFVD 309

  Fly   361 -VYSKRNKLTLA 371
             :|.|:..|..|
  Fly   310 MLYGKKAPLATA 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 84/327 (26%)
EamA 219..362 CDD:279264 44/149 (30%)
meigoNP_001097853.1 UAA 8..311 CDD:285625 83/324 (26%)
EamA 169..308 CDD:304911 44/145 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451127
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D440867at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10778
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.