DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and CG5281

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_650076.1 Gene:CG5281 / 41375 FlyBaseID:FBgn0037902 Length:347 Species:Drosophila melanogaster


Alignment Length:287 Identity:59/287 - (20%)
Similarity:96/287 - (33%) Gaps:74/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 PEPRCIPMRTYLILAALTLGTMGLSNSSLGYLNYP----TQVIFKCCKLIPVLVGSILIQGKRYG 189
            ||.:    |..|:|... :||.||..|...:.:.|    :.:||.    .||.| :|..:.    
  Fly    93 PEGK----RVILLLRCF-MGTTGLMLSFYAFRHMPLADASVIIFS----TPVFV-AIFARA---- 143

  Fly   190 LLDFAAATCMCIGLAWFTLADSQMTPNFNLLGVAMISG-------------------------AL 229
               |....|....:         :|.|..||||.:|:.                         |.
  Fly   144 ---FLKEPCTLFNV---------LTINMTLLGVVLITRPPFVFGDTAESEDVAGKTYDIWGPVAA 196

  Fly   230 LCDAAIGNVQEKAMREFKAPSSEVVFYSYG-LGFVYLFVIMLVTGNFFSGFAFCLEHPVETFGYG 293
            :.....|......:|..|.....|:..::| :..||..::....|      |.|...........
  Fly   197 ISSTLFGANVYILLRALKNLHFSVIMTNFGTIALVYTLIVCASIG------AVCWPSCGRDRWLV 255

  Fly   294 FLFSLSGYLG-IQFVLALVRSSGAPIAATVTTARKAVTIAFSFV---LFSKPFTLQYLWSGLIVV 354
            .:..:..:|| |...|:|......|:|..     :...|.|:||   ||.......|...|.::|
  Fly   256 VVLGVFSFLGQILLTLSLQIEQAGPVAIA-----RCADIVFAFVWQMLFFGETPTAYSLVGAVMV 315

  Fly   355 LGIYLNVYSKRNKLTL---ADVRQRIK 378
            :|..:....|:...||   :.:|:|.:
  Fly   316 MGSVVLTALKKWAGTLPRESSLRKRFR 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 54/268 (20%)
EamA 219..362 CDD:279264 33/172 (19%)
CG5281NP_650076.1 RhaT 38..328 CDD:223769 55/271 (20%)
EamA 38..169 CDD:279264 26/101 (26%)
EamA 189..324 CDD:304911 28/145 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.